PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000693678
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 252aa    MW: 27535.6 Da    PI: 6.4233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000693678genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.4e-191459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+++Ed  l+++v+q+G+++W++I+  ++ gR++k+c++rw + 
    MDP0000693678 14 KGSWSPQEDATLIKLVAQHGPRNWSLISTGIP-GRSGKSCRLRWCNQ 59
                     799*****************************.***********985 PP

2Myb_DNA-binding475.8e-1568110347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++ + d  +++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000693678  68 PFSXQXDSVIIQAHALHGNK-WATIARLLP-GRTDNAIKNHWNST 110
                      6778888999**********.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.411964IPR017930Myb domain
SuperFamilySSF466891.42E-2812107IPR009057Homeodomain-like
SMARTSM007179.0E-161362IPR001005SANT/Myb domain
PfamPF002491.9E-181459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-231567IPR009057Homeodomain-like
CDDcd001676.66E-151658No hitNo description
PROSITE profilePS5129417.92765115IPR017930Myb domain
SMARTSM007173.0E-1165113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2068113IPR009057Homeodomain-like
CDDcd001671.88E-968111No hitNo description
PfamPF002493.8E-1268110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MAMKGAXSGE DRVKGSWSPQ EDATLIKLVA QHGPRNWSLI STGIPGRSGK SCRLRWCNQL  60
SPTVQHKPFS XQXDSVIIQA HALHGNKWAT IARLLPGRTD NAIKNHWNST LRRGRQRAEX  120
SSTSSGSDLA AAVGDEPDMK RQCLRASPEH ESLKANAGGE GVIVETSLTL SPPGEKAENE  180
VVLKSEEEED GHEAVDNNDD VENCRVETEE TSLLKIMHRM IAREVRNYID SLRENGGPTF  240
GLQSAAHQND P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-37131133103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700271e-134KC770027.1 Pyrus pyrifolia microsatellite TXY079 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374172.11e-179PREDICTED: transcriptional activator Myb-like
TrEMBLM5XTD91e-122M5XTD9_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01360.t012e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-53myb domain protein 73